PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010919080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MIKC_MADS
Protein Properties Length: 245aa    MW: 27978.5 Da    PI: 4.8684
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010919080.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.31.3e-303787151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye+ss
  XP_010919080.1 37 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSS 87
                    79***********************************************96 PP

2K-box73.18e-25106199598
           K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                     ++++++e++ ++++ e+a + ++ie+L+ ++R+ll e+Les+s++eL+++e +Le+sl++iR +Kn+ll eqi +l++ke+ l++en+ L++k 
  XP_010919080.1 106 NNNEVTEQNIQQCKFEAASMSRKIESLEASKRKLLAESLESCSVEELHEIEGKLEQSLRNIRGRKNQLLGEQIAQLKEKEQTLEKENTLLQEKC 199
                     456699*************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.3E-422988IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.2822989IPR002100Transcription factor, MADS-box
CDDcd002659.01E-433198No hitNo description
PROSITE patternPS0035003185IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-313151IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-3331109IPR002100Transcription factor, MADS-box
PfamPF003194.3E-273885IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-315166IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-316687IPR002100Transcription factor, MADS-box
PfamPF014868.3E-26111200IPR002487Transcription factor, K-box
PROSITE profilePS5129714.44115207IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MSSTSLFSSF YFCETWTPAE EEEEEEAEMV RGKTEIKRIE NATSRQVTFS KRRNGLLKKA  60
FELSVLCDAE VALIVFSPRG KLYEFSSTSM QKTINRYRMH AKSGINNNEV TEQNIQQCKF  120
EAASMSRKIE SLEASKRKLL AESLESCSVE ELHEIEGKLE QSLRNIRGRK NQLLGEQIAQ  180
LKEKEQTLEK ENTLLQEKCK LQSQPPLADL EEADPDEQDG QHNEVETELY IGCPGRGRIN  240
CMSPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-193197268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-193197268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-193197268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-193197268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J2e-193197268Myocyte-specific enhancer factor 2A
3p57_I2e-193197268Myocyte-specific enhancer factor 2A
3p57_D2e-193197268Myocyte-specific enhancer factor 2A
3p57_C2e-193197268Myocyte-specific enhancer factor 2A
3p57_B2e-193197268Myocyte-specific enhancer factor 2A
3p57_A2e-193197268Myocyte-specific enhancer factor 2A
3kov_J2e-193197268Myocyte-specific enhancer factor 2A
3kov_I2e-193197268Myocyte-specific enhancer factor 2A
3kov_B2e-193197268Myocyte-specific enhancer factor 2A
3kov_A2e-193197268Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919080.11e-180PREDICTED: MADS-box protein SOC1-like isoform X1
SwissprotQ9XJ602e-86MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLQ400I01e-124Q400I0_ELAGV; AGL20-like MADS box transcription factor (Fragment)
STRINGGSMUA_Achr5P10250_0011e-86(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-69AGAMOUS-like 20